PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr025605.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 388aa    MW: 43679.6 Da    PI: 8.5175
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr025605.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1578.2e-49151421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhP+deel+v+yL++k+ + +l++ + i+e+d+yk++PwdLp+k+  +e ewyfFs+rd+ky++g+r+nra++ gyWka g dk++l++ ++
  Pbr025605.1  15 LPPGFRFHPSDEELIVHYLRNKMISYPLPA-RLITEIDLYKYNPWDLPNKALFGEGEWYFFSPRDRKYPNGDRPNRAAALGYWKAAGGDKPILTScGS 111
                  79****************************.89***************88778999*************************************99888 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  el+g+kk Lvfy+grapkg+kt+W+m+eyrl
  Pbr025605.1 112 ELIGVKKALVFYTGRAPKGVKTEWLMNEYRL 142
                  99***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5812152IPR003441NAC domain
PROSITE profilePS5100555.76815209IPR003441NAC domain
PfamPF023651.8E-2416142IPR003441NAC domain
SuperFamilySSF1019411.57E-58197207IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEKEPAFTTS STLQLPPGFR FHPSDEELIV HYLRNKMISY PLPARLITEI DLYKYNPWDL  60
PNKALFGEGE WYFFSPRDRK YPNGDRPNRA AALGYWKAAG GDKPILTSCG SELIGVKKAL  120
VFYTGRAPKG VKTEWLMNEY RLLDSTINPS RSKGSMRSHH ALTTSRANLA IPLEFNILDL  180
ALYYNNCAFK SETQIVELDD WVLCRVQQRG NTTKNTCNPQ DIYNTESWRC LPKAGPTQPT  240
DPIHRADLIT DFLYKDCRLL AFMLAGQAPS PIETNSSASF QGRKDSCEVG SNNKVKSTIS  300
VSSSGISSTL KRKIREENTK ENLFPLITLE SKNKDGNVLP GKRLAADNVV NCYIPNHLQN  360
DIPKANPTVP ANFEEFDEMS FLATYFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-611121513171NAC domain-containing protein 19
4dul_A2e-611121513171NAC domain-containing protein 19
1ut7_B2e-611121513171NO APICAL MERISTEM PROTEIN
1ut7_A2e-611121513171NO APICAL MERISTEM PROTEIN
1ut4_B2e-611121513171NO APICAL MERISTEM PROTEIN
1ut4_A2e-611121513171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009335094.10.0PREDICTED: NAC domain-containing protein 2-like
SwissprotA0SPJ61e-69NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLM5W7331e-161M5W733_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g03080.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.14e-70NAC domain containing protein 25